DPCstruct | MC2155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 187 ± 33 aa |
| Standard deviation of domain lengths | 33.28 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.45 |
| Pfam Score | 99.17 |
| Assigned Pfam label(s) | PF01184- PF01300 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A243UYM7 | 7-169 | ANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFYGGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDA… |
| A0A428QEJ1 | 19-185 | EDRTQPSLPVVHRRFANPSPLGLLSFATVLIFFGGICQYLVGIMEFVAGNTFGTAVFMSYGAFNISYSMIYLPGSGIIAAYMDSEGN… |
| A0A1N7GZC4 | 1-255 | None |
| A0A5K1JXN3 | 26-166 | None |
| A0A366S6C9 | 30-232 | None |
| A0A2N6FQF6 | 66-262 | None |
| M1V8U8 | 90-271 | None |
| A0A821DMH0 | 10-224 | None |
| V4J3B8 | 7-186 | None |
| A0A5S6QAP4 | 8-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.