DPCstruct | MC21549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 174 ± 21 aa |
| Standard deviation of domain lengths | 21.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7ZB28 | 32-181 | PPELNQICIDVNRDTHTIRSLLKPSNGDERQICKPIWEDQGIGWTFLRTSAGPWQTRIPVSKREMIIVSTQLIMNYTDHPNAPSQTL… |
| A0A1I7TJ43 | 1-186 | MPPEIDRICVTVSPSSHMIYTSILNASPFESALQLRKRLNKLNAPKDQRAVTECKPLWEDGGLGIGLARREAGVWEMRTPINNSMLA… |
| A0A2A6B4R5 | 1-192 | None |
| Q18003 | 203-416 | None |
| A0A368GID3 | 122-307 | None |
| A0A1Y3EF44 | 540-702 | None |
| A0A1I7X5W4 | 72-220 | None |
| A0A3P7NR59 | 1-156 | None |
| A0A7I8X9T6 | 422-574 | None |
| A0A016WEN2 | 282-469 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.