DPCstruct | MC21544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3MR93 | 1-126 | MDQPQLHKPREPLKVGPRGGKVYTPPGKGMDIRKWNKEDVDMWMTCFLRPDMYPNTYLATTKQQIDGETLYWMVKEPQKDIHQVLQI… |
| A0A1I7T6E7 | 6-118 | EQREGDGADIEVIAQFPETPSNPPTPGPPCVLIPPGQTNDISAWKKVDVLRWISCFLPPNYYPKVFIALNRLDIDGEILRSIIERRP… |
| A0A2G5TZ90 | 539-641 | None |
| E3MR92 | 1-112 | None |
| A0A2G5U0V7 | 5-104 | None |
| G0NRD7 | 1-107 | None |
| A8Y248 | 131-241 | None |
| A8XX13 | 1-104 | None |
| A0A2G5SR06 | 41-166 | None |
| A0A2G5SQV1 | 18-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.