DPCstruct | MC21543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 149 ± 22 aa |
| Standard deviation of domain lengths | 21.96 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 68.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7SZV5 | 6-161 | ASEYTIKQPDLKDILVQNEDESIEGMGTNGVTDAEIVIEKENTTKPTHDRQSWTMRLISSDSFNASMAVEYLNSIQDKPSLSFLGKR… |
| A0A2S2R670 | 1-130 | MASSCSRESLSCSEPSPSKQGGYDTQTFDKVSKSFLLRLIESKLFDMPMAIMYLFNSKEPGVQRYIGDKLFSFDDNSVDFFLPQLIS… |
| A0A5J4NT74 | 1-139 | None |
| A0A0V0J396 | 1-143 | None |
| A0A6L5C8M2 | 208-387 | None |
| A0A183J760 | 60-213 | None |
| A0A820TLL4 | 27-186 | None |
| A0A0R3TEF2 | 2-147 | None |
| G3NFV1 | 85-228 | None |
| A0A6P7FXX8 | 169-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.