DPCstruct | MC21542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 146 ± 9 aa |
| Standard deviation of domain lengths | 9.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7SXD0 | 1-155 | MQMHLASEGTYQQNPFFLSLVYHLMENTTEVVELIHSYPFKNRSEPMKFARAKLYMYHFTNKTERGWWKRDYQEEYMPVFNKGNQAL… |
| V5G3L6 | 362-505 | QMYWAAYSTYEKQPWLLSLTHRLLVGKPEVLALLDKLHSPYTQKPPRYIRGILYRYKYTPWSQKSQSTWWVRERVSEYFPAFSRDSP… |
| C4WWZ8 | 1-139 | None |
| F1L4I2 | 259-410 | None |
| F6VR50 | 51-201 | None |
| A0A3P7E530 | 240-366 | None |
| A0A2B4S7Y5 | 509-669 | None |
| A0A094ZYU1 | 419-551 | None |
| Q16KB9 | 106-248 | None |
| A0A1B0GKY3 | 44-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.