DPCstruct | MC2154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 161 ± 18 aa |
| Standard deviation of domain lengths | 18.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0V522 | 5-162 | ALITLAQDAEDASSGLRVFRDSLPRNATQITGVIGEFFAISATLRQLDSAEGDPRLQPSFYRIREDVGLLCRSLQTTVGDVFAMFAR… |
| A0A1E1L442 | 1-141 | MEVLLGAWREALRADRAGVELVRIRAELQHDFYDHITAVLRGIESTSRLLRDLYDLFPIYRSRVPMIVYYLDITLPSIEKTIKLMMA… |
| A0A218ZCP2 | 1-175 | None |
| H0EQE5 | 38-223 | None |
| A0A1Q8S6X1 | 1-129 | None |
| A0A0G4KN90 | 15-195 | None |
| A0A0C3CS67 | 1-160 | None |
| A0A2S7NWG9 | 1-160 | None |
| A0A0N1H844 | 1-191 | None |
| A0A4Q4UH80 | 10-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.