DPCstruct | MC21533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 287 ± 30 aa |
| Standard deviation of domain lengths | 29.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7P340 | 1-287 | MWHEARKQERKIRGMLVDLKKRAERRKEFYERIKQDPAQFLQLHGRRCKIHIDLAIAQAADSPATMMPWQGHPDIMIDRFDVRAHLD… |
| A0A1V9XBC5 | 10-322 | WTEARKQERRLKGMMVDYKKRAERRREYYDRIKTDPAQFMQVHGRSLKIHLDPSLAAQAEAPSTMVQWQNQADTIIDRFDVRAHLDV… |
| H2YGJ1 | 1-291 | None |
| A0A0J7KL41 | 12-285 | None |
| A0A6I9ZCK6 | 1-247 | None |
| A0A267FXR6 | 1-298 | None |
| A0A034VXS9 | 2-329 | None |
| A0A0C2IX14 | 1-231 | None |
| A0A485NRL4 | 2-234 | None |
| A0A6P7FPM1 | 3-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.