DPCstruct | MC21532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 54 ± 4 aa |
| Standard deviation of domain lengths | 4.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 59.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7W274 | 86-142 | LVDKVDEAASALHQTQMRLRSPKKISTPYGGRLSFIMPGKNRLMIHLKDKQKIRIRK |
| A0A7R9BAC0 | 1-54 | MKTMDETVQSFHGIRLQPPTAFPTPYGGRLVWTLPGKTKILVHLKDKDKIRHRK |
| A0A820PDV8 | 54-114 | None |
| A0A0L7KX06 | 46-97 | None |
| A0A182T4V4 | 510-563 | None |
| W2SVJ2 | 244-300 | None |
| A0A820ZGB6 | 18-74 | None |
| K1PNU5 | 124-173 | None |
| A0A815V6Q1 | 5-63 | None |
| A0A0C2CBA8 | 8-53 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.