DPCstruct | MC21530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 147 ± 25 aa |
| Standard deviation of domain lengths | 24.58 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A072NH62 | 2-135 | LNDQEIEVFNSNEYYGLQALAAAWEATQYSEDIYTSTSLHNGNGDAYRHIMWNALMKKYTTSTYAKQFAAAHENGSTGQPAIEKQMD… |
| A0A0U1DHB6 | 20-163 | GDANLTVGEYRVLAELAATQGPFAVKDFFDIKQAAIDEAGRKFPPPDGNTSDNHTDAFRHTYWNALMTQRFGEEWTRKFATAHERRP… |
| A0A7Y4Y320 | 51-193 | None |
| E6LJP1 | 80-261 | None |
| A0A7X3SJP3 | 13-141 | None |
| A0A4S3LQ81 | 156-346 | None |
| Q12WZ0 | 97-233 | None |
| A0A380ZW29 | 44-189 | None |
| A0A838Z360 | 154-288 | None |
| S5ZND2 | 4-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.