DPCstruct | MC2153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 155 ± 12 aa |
| Standard deviation of domain lengths | 12.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E1KC81 | 1-131 | MLLEHDLYDEEEDEFVCGRAYCGSRLSVGSGAKYWPGFDKEGGVERVHGWPGSHCTIHLEELINKKQSNTGNCCAKISKNDVGREVL… |
| A0A364MYA9 | 365-514 | FPAQLNLEDILDTAIELLPDDAYALVLLVNHDIYENDNDDFCCGRAYGGSRVAVVQSARYNPLLDAKANIQRDHMWPLSHCKGFVDG… |
| A0A420T4N9 | 215-367 | None |
| A0A428RZQ7 | 93-246 | None |
| A0A6A6ULI5 | 274-453 | None |
| A0A0F8VDP9 | 1-184 | None |
| A0A1B8AKG0 | 674-830 | None |
| A0A178A805 | 203-350 | None |
| A0A5M3Z821 | 652-802 | None |
| A0A2T4C0R6 | 373-539 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.