DPCstruct | MC21529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 466 ± 41 aa |
| Standard deviation of domain lengths | 40.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 59.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813K417 | 503-978 | VNPVLREGNSDRRAAVSVKEYAFKYPHSMGKWAPDCKTHVASMHYGDFYSHEKSVCLSEACEARIELVAEDGSVSVLKEKLPLKAGE… |
| A0A800DYV8 | 43-523 | VNPVLREGNSDRRAPKAVKNYARKNPHKMGAWSSNSKTHVATMSEGDFFHNEKSLTIEKATNIRIEFVDTHGNKTILKDNFAILDSE… |
| A0A1Q9DTP5 | 1-451 | None |
| A0A7C4IA93 | 1-370 | None |
| A0A829Q7K4 | 1-440 | None |
| A0A7V3CY13 | 134-615 | None |
| A0A813ATT5 | 135-623 | None |
| A0A6S8BB53 | 255-778 | None |
| A0A6U6VWK9 | 552-1032 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.