DPCstruct | MC21523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 285 |
|---|---|
| Mean domain length (aa) | 259 ± 51 aa |
| Standard deviation of domain lengths | 50.65 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 13.24 |
| Pfam Score | 38.26 |
| Assigned Pfam label(s) | CL0276- PF13675- CL0161- CL0681- CL0183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U5W2J4 | 5-214 | KIPVRLAIGLGAVASIGIAIALLGAVALRSLTANLQEITADRMAKVAQFTELKDNLNAIARYARNIVISGNTAVQREEKRKLAELRE… |
| B8GFV2 | 7-249 | LMLSFSVLAVVFLIAGVIISANVTGMNALDKRISTDLTINQQAIAYQNAARDVQTGTFLYLQGETGMGNQMINEGELQMVKSRLALN… |
| A0A5C8KA58 | 27-248 | None |
| A0A844YT43 | 15-238 | None |
| A0A2G7GCY3 | 198-418 | None |
| A0A244C0B5 | 3-189 | None |
| A0A351I9V4 | 3-276 | None |
| A0A447PXV1 | 2-158 | None |
| A0A161R7L8 | 5-305 | None |
| J3C4C4 | 5-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.