DPCstruct | MC21522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 420 ± 53 aa |
| Standard deviation of domain lengths | 53.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0WL59 | 54-439 | GPTVVLPNLSTATITKASMGLLLQLMNQQFDAKNEFTISKFTYNGQDYGPQCYLQDESMIPKASELTCTREPFVFAPIDYMYEDLDG… |
| A0A444RTY9 | 3-427 | VFLTWMGLASDQDEHFNDVVTTATYRNTDGLRDALKEGDSSLRRFMDSQAWQHQSSHVNFNMTLSEKAQGHGTTVIVTNPRASPMQA… |
| A0A0F0I9K3 | 105-526 | None |
| A0A0G4FDC9 | 154-689 | None |
| A0A836BAJ2 | 187-670 | None |
| A0A397F5A1 | 1-376 | None |
| A0A3R6YE10 | 32-372 | None |
| G2X578 | 210-641 | None |
| S3D011 | 210-613 | None |
| A0A166CKW7 | 197-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.