DPCstruct | MC21521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 199 ± 36 aa |
| Standard deviation of domain lengths | 36.43 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 66.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444RS51 | 1-164 | MVICKFWDAGNCRFGQNCRFEHPNTNRAQTSNRFSAFNNLSSGGGFGNGSSDNGSNTYSITKETIEKDLTTERPQWILSAYGPGRDA… |
| A0A5M8PRB5 | 1-186 | MPAVLCKFWQRGHCKNGDRCNFEHPGRGNQFHSQNRFGVFQSPGSNASNSPGTGAFGGSPSTQDYPYHLTKDGITDDLTKDLPIWIL… |
| B9RL60 | 1-235 | None |
| A0A1Y1LA38 | 2-217 | None |
| A0A154PQM9 | 1-184 | None |
| A0A445HZW2 | 3-253 | None |
| A0A7I4E4A4 | 3-221 | None |
| A0A397IQF3 | 3-187 | None |
| A0A3M7S6L3 | 246-471 | None |
| A0A812ALX9 | 1-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.