DPCstruct | MC2152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 314 ± 48 aa |
| Standard deviation of domain lengths | 47.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9QRY8 | 7-282 | GRPSRLNQGPERPSEIGSAVSRELSFVFEDPPSRKETTTKAEPSDKLPERFIGLANDLSHEDGQLKRRKEEKLDGPRRVWEKLAELK… |
| A0A1E1K3G7 | 1-368 | MGLRKRIDDFCGTDAEYIEYLETKVCQLTAIESPPSPARSVVREDAINNCDSDEYPITTLAFIEYDPQTDRVDLSSQSPAPKRQRIQ… |
| A0A420MP22 | 1-231 | None |
| A0A0F7TFU3 | 1-294 | None |
| A0A1Z1C4K4 | 43-390 | None |
| G2QM15 | 1-348 | None |
| S0EBH7 | 5-323 | None |
| A0A0M8NQ14 | 1-360 | None |
| A0A428SJA9 | 3-275 | None |
| A0A6A6FFF4 | 1-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.