DPCstruct | MC21518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 150 ± 24 aa |
| Standard deviation of domain lengths | 24.48 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11800 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B2ERD2 | 1-108 | MILEACPTLSDYPEPIEDVSDIVAAGRYLRGSLGANESAWNEAVAEIGLVRAAVTVIYVLQLYDDDVSSGEGRIKNPGGYFRAMARL… |
| A0A1L9NRP6 | 11-138 | ETAKKPAEHLARKTKCYEIEKDQSNVPIQIVRAHCREIWNYTDTSLTHWAQLVEAAQKVGPMMGLHKSVWDETVDAMGQVEAAIVVA… |
| A0A166DS79 | 130-316 | None |
| A0A4Y1MRD6 | 183-355 | None |
| A0A0N8IBB6 | 4-116 | None |
| A0A839EPZ8 | 24-161 | None |
| A0A178HNW1 | 203-374 | None |
| A0A1G7FKF8 | 424-557 | None |
| A0A533I4U7 | 43-231 | None |
| A0A1I1Q0I4 | 179-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.