DPCstruct | MC21517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 108 ± 31 aa |
| Standard deviation of domain lengths | 31.33 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1CKV7 | 77-178 | VGGGANGIGSGFKRTIPSKLPDANALPKGNPAKIERNASPEKIRALERENEAAKKLVEYGYDIEQNPKVGPNDGIGLDKKPDFSIGG… |
| A0A354WFI7 | 1-95 | MTVTQPLGQPGGRPTGYSRIPRYNDDADTTRSIERENESAIILANAGYNVEQNPTVSGDKNPDYRIEGRIFDCYAPSTKNFRNIIET… |
| K6TQG8 | 894-992 | None |
| A0A7X3A6N4 | 142-220 | None |
| A0A1C4Z619 | 2-110 | None |
| A0A511HMU2 | 405-497 | None |
| A0A4R6JQ56 | 1-192 | None |
| A0A0D5WVG0 | 346-433 | None |
| A0A7X5Z3G5 | 456-568 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.