DPCstruct | MC21514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 7.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3R5N0 | 51-133 | YKSDLDLIGGMNLNIQGWGMEDVDFFERCVHSPLRIMRAPDPGLVHIYHTIHCAESLPEKQYIMCIGSKAASLASLDSLVDQL |
| A0A2D4GWW2 | 1-105 | MTCQFRSDYINIGGFDLDIKGWGGEDVQLYRKYLHSNLMVIRTPVRGLFHLWHEKHCLDELTPEQYKMCIQSKAMNEASHDQLGLLV… |
| A0A814GTG5 | 65-154 | None |
| A0A5B7JG60 | 1-96 | None |
| A0A5B7FJB4 | 1-112 | None |
| A0A820LUJ2 | 15-107 | None |
| A0A482WGG9 | 1-88 | None |
| A0A4Z2H0X6 | 229-323 | None |
| A0A2T7PYN7 | 386-490 | None |
| A0A811YT72 | 58-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.