DPCstruct | MC21513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 186 ± 27 aa |
| Standard deviation of domain lengths | 27.42 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4GV97 | 1-176 | MDSLKELDQRLFEIYIELKADPIVGSLEPGIYAGYFDWKDCLPPTGVRNYLKEALVHIIAVHAEVFTISKELVPRVLSRIVEAVAEE… |
| A0A0B1SIK4 | 2-170 | FDCGVKYADEVYDKAKAKLSLYRQTLVRCYIMIKSSAYSTLIESANYEYIPDDDVSDYAKEMMMCCVLQQAELELCSPQLTSECLQA… |
| A0A7R9B323 | 157-311 | None |
| S4PBV3 | 3-136 | None |
| A0A7S0DFJ0 | 948-1140 | None |
| A0A409WQZ3 | 107-308 | None |
| A0A4Y9ZJ35 | 1-219 | None |
| A0A0D6EGW0 | 305-487 | None |
| A0A1D6J6X6 | 97-347 | None |
| M8AR19 | 2-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.