DPCstruct | MC21511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 134 ± 24 aa |
| Standard deviation of domain lengths | 23.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.35 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0014- PF02769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A455UI51 | 1-159 | MRVTLFEEPLLETTRQLTQRTWAETSYRMQALRDNPECAKNEYDNLLDSRDPGLSATPTFDINDDISAPFVNTAKPAMAVLREQGVN… |
| A0A3P8KGV9 | 2-100 | QRLRDNPECADSEHAAKSNDSDPGLNVKLSFDINEDIAAPYIATGARPKVAVLREQGVNSHVEMAAAFHRAGFDAVDVHMSDLLAGR… |
| A0A834T600 | 299-414 | None |
| X8JJB5 | 1012-1128 | None |
| A0A5J5AYX8 | 556-679 | None |
| A0A377AII4 | 2-122 | None |
| A0A376TUS7 | 1-121 | None |
| A0A377LV97 | 106-251 | None |
| A0A3S4FKK0 | 617-733 | None |
| A0A7I8C8K2 | 3-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.