DPCstruct | MC2151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 4.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A014PGA8 | 320-403 | RRELQRVVRRAKRQYWRILIDGFSDGAAVYKAVRWLKSPGAFQPPPLQIGDDVYETQLDKANVLGHSTLERRTVADNIADPWIL |
| A0A834VPW0 | 38-114 | VVRKAKKEYWANRINNITTDEELYSLLGWHKLTLGQQDIPLIVNNQTISDPLEKAEALRVEILDRFSAEDDLPEPVW |
| A0A395IM23 | 425-512 | None |
| A0A0F7ZJB8 | 193-281 | None |
| A0A559M4W7 | 1-81 | None |
| A0A7T6XUI3 | 216-303 | None |
| A0A7T6XKL1 | 164-239 | None |
| A0A420NC25 | 93-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.