DPCstruct | MC21508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 211 ± 43 aa |
| Standard deviation of domain lengths | 42.58 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 93.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T2KWJ8 | 63-229 | AQDYPLLPYLKLKEHLNNLSALKSDQVELFLATYSDTPLANRLHSAWLKHLAKKKRWWTYRAFYKPTRSTSQQCTYLWALFNTGKAQ… |
| A0A455UD23 | 3-206 | RFINQYEDSPLAGWMRGQAIAHYGHAGRFSDLLSVADGEPAGTARQCYYYTALFASQPQQASEAGLDLWRVGSSQPNACDPLFDRLR… |
| W0BCA2 | 43-227 | None |
| F3C2I9 | 3-271 | None |
| A0A485BRB2 | 5-176 | None |
| A0A6I7WRY7 | 3-223 | None |
| A0A379BBZ0 | 12-243 | None |
| M4S9X2 | 3-290 | None |
| A0A3P8J6Q6 | 1-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.