DPCstruct | MC21506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 172 ± 18 aa |
| Standard deviation of domain lengths | 18.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6VR95 | 5-169 | LREKHYEQWREFEAQAEQAVHFVGKLYRDHGIITTLYNRPLVGRTPMQLLQEHKYVAAVEGNDFNINRTFPLLQAMVDMPLTPARID… |
| A0A455UAZ8 | 1-205 | MSQQALENVFQEWQGNEALAEQMIPLVGQLYRQNNVVATMFGRSLIKRSVIRILKDHRFVRKLEGTELSVEDTYPILKSMVALNLGP… |
| A0A0P9Q365 | 11-188 | None |
| A0A060JL07 | 600-765 | None |
| R7W2F8 | 2-162 | None |
| A0A812RMB3 | 47-232 | None |
| A0A7J6YZ55 | 2-139 | None |
| A0A3R7GXE7 | 12-204 | None |
| A0A7U6QPD7 | 8-176 | None |
| A0A6M1Q5B6 | 8-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.