DPCstruct | MC21503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.44 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0187- CL0508 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8F1V4 | 2-93 | IGLPGEHIVRKRETLLDVARKYDLGFNEMHDLYPGLDPWLLQEGMALTIPTQWILPERNFRGIVINVAELRLYYYFNDGCPRVMTFP… |
| A0A455U8G5 | 59-132 | ELPRGHFRLPESGDVIGKRYTVVVEDPEQTLIDIARRHNIGYEEIRMANPDVSLWVPGVGTEVVIPAQYILPPA |
| A0A377M442 | 88-196 | None |
| A0A7H4MGD2 | 1-91 | None |
| A0A377D7K0 | 1-96 | None |
| A0A1A9X6L9 | 60-142 | None |
| A0A0B8PA21 | 1-80 | None |
| A0A2E7E416 | 8-126 | None |
| A0A2A6Q3X1 | 27-114 | None |
| A0A1Y6D4W0 | 19-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.