DPCstruct | MC21501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 3.75 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 68.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379WLX5 | 47-115 | KPVTLRTLDVGADKQLPYMPISEENPCLGWRGIRITLDQPEIFLIQVRAMLRANAATGNLSILLPMVTS |
| A0A455U7D7 | 1-60 | MVMRTLDIGGDKDLPYFPIEEANPFLGWRGMRVTLDHPEVLMVQLRAMLKASMVWIISTY |
| A0A538MID8 | 1-63 | None |
| A0A1C6HI28 | 325-390 | None |
| A0A378BSD4 | 107-175 | None |
| A0A844VXT4 | 20-79 | None |
| A0A090RTF9 | 185-251 | None |
| A0A377U3T1 | 203-269 | None |
| A0A455V471 | 14-77 | None |
| A0A7H4M6V2 | 419-485 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.