DPCstruct | MC2150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 151 ± 14 aa |
| Standard deviation of domain lengths | 13.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 48.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J8QK08 | 219-366 | ALDCLPWSSLSWSIHRGMRDILVAFAKPRMDRYRDQLAETLRSAVDRWPEKLVARGWDAQFIRRDMAHMATSAVAAGSGNSGDVVRI… |
| A0A1E1K166 | 15-170 | MNRGLKDLLLAVGIPTLNRYRDSLASLLKGEILLSREALVAMQWSREFVYGPMSEIAFAAVTSGVGNSGDIVRIVTAAVDVFLVRNG… |
| A0A0A2LDD2 | 115-269 | None |
| A0A1Y6M288 | 1-143 | None |
| C9SBF3 | 1-138 | None |
| A0A225AQJ4 | 234-381 | None |
| A0A0G4M140 | 257-412 | None |
| A0A0G4LPB2 | 860-1015 | None |
| A0A2J6TSY4 | 330-493 | None |
| A0A5N6FRF4 | 254-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.