DPCstruct | MC21497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 246 ± 50 aa |
| Standard deviation of domain lengths | 49.85 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00460 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A455UZD8 | 2-142 | QNFFSALEDLASAPSDPAARQGVLGTADTLTAQFRSFDGYLQDLQSGVNGQIKDEITQINNTTSQIANINREIALSRAQLGEAPNSL… |
| A0A455U2Z7 | 4-269 | FSIGLSGLNAAQNALNTSSNNISNVYTPGYNRELAQLGEGRVGGGVRVNDIERQFNTYVADQLNSAKTQSSALNTYYNQVSQIDNLL… |
| N1ZDT9 | 11-331 | None |
| A0A1I8APY8 | 1-191 | None |
| A0A015KSF0 | 16-210 | None |
| A0A258D969 | 1-227 | None |
| A0A7X7Y2P5 | 1-279 | None |
| A0A7C3AS12 | 3-213 | None |
| A0A0B0I5M6 | 2-124 | None |
| K6UMD5 | 152-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.