DPCstruct | MC21493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 78 ± 4 aa |
| Standard deviation of domain lengths | 4.07 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0043 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0ST27 | 36-114 | PPASEIAALVSEIQEQEVPAIFAENVSNNDLMQTIADEAGVTLAPPLYTDALGEPGSEGDTYIAMLTYNTDTIVTALGG |
| A0A455TZR6 | 2-71 | AALVDVIEQENVEALFHENMTNQSIITQLAEETGLPIAGTLYADALASEDEASTYLGMMRHNAQVLHDAL |
| A0A7W0A923 | 156-237 | None |
| A0A847ESA2 | 3-72 | None |
| A0A7Y3BE31 | 1-83 | None |
| A0A5C1QR59 | 52-126 | None |
| A0A846BXG4 | 32-113 | None |
| A0A7X7D2K9 | 5-82 | None |
| A0A812RIN7 | 103-182 | None |
| A0A3S4K9V2 | 56-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.