DPCstruct | MC21491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 10.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5K0P3 | 5-89 | NMFKWGQSMASRDPKIADDHLDEVRVSTIFLGMDHNSDDDGPPLLFETMVVGGALDQFRMRCTTYEEAEIMHQIVTAMVKREREN |
| A0A0F9VJP0 | 4-91 | HYDRDGNELTLLAWAEKLEDDDYRRVELTERDDIKVSTVWLGLNQDFTGIGPPVIFETMVFGGDHDGKQQRYSTEEQARAGHAEVVTE |
| A0A0H2M6M7 | 2-77 | None |
| A0A2N4TXT2 | 1-101 | None |
| A0A356HIS8 | 27-118 | None |
| A0A7C2A7J4 | 2-102 | None |
| A0A0F9C1H0 | 34-133 | None |
| A0A176Z9G7 | 77-170 | None |
| A4YUS4 | 10-113 | None |
| A0A518B6P7 | 12-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.