DPCstruct | MC2149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 125 ± 9 aa |
| Standard deviation of domain lengths | 9.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834FHL5 | 17-141 | PQNFVESLPLEMSVRIFGELDAESLCRASQTCRRWHAIIQQSEQLWRGQGLQVRAVCQREVDRDRSDGHSWKVTVVRNFARSRLKAD… |
| A0A091KN22 | 4-113 | LPPEVSSRIFSDLDVESLCHAAATCKGWHRVIESDDRLWRHHCLSARAAFSCLFFHQITLLRNYWKSKVKQEWLSGKYSNIPSQNSL… |
| A0A0F8ADM3 | 1-114 | None |
| A0A6P3VYH8 | 21-159 | None |
| A0A2Y9RAI1 | 106-241 | None |
| A0A210PP07 | 32-155 | None |
| A0A7M7RE41 | 14-135 | None |
| A0A3M6TYI8 | 5-122 | None |
| A0A7R5L157 | 171-296 | None |
| A0A6P6EXG1 | 93-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.