DPCstruct | MC21487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 12.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19663 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0V2D1 | 2-103 | KTYVGKICEDGAYRVVIEDERGSVSPLPLRLDLANKSPTGFSWGYSGSGPAQLALALLADAIGEKEALEVYQDFKRAFVAVLPAEWY… |
| A0A523IJK7 | 3-111 | KIKIYRGYRKDGIPIVEVEEIDLTGVNTRMLENTKRHGSDFFEWGYSGAGPSDLARAILLDMKFPKKEVDSLYQDFKYAFILPADFD… |
| A0A523DAP3 | 3-118 | None |
| A0A6B9F025 | 6-103 | None |
| A0A7V9HA93 | 2-113 | None |
| A0A258S7E3 | 123-235 | None |
| A0A0A7LQL5 | 16-112 | None |
| A0A2R2IWI3 | 6-104 | None |
| M0MGM7 | 16-125 | None |
| A0A7C2ZTD8 | 56-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.