DPCstruct | MC21482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 326 |
|---|---|
| Mean domain length (aa) | 94 ± 16 aa |
| Standard deviation of domain lengths | 16.36 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.02 |
| Pfam Score | 82.62 |
| Assigned Pfam label(s) | CL0063- CL0182- CL0582- CL0030- CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0ZCS4 | 7-80 | AEETVETVEVSPDSPVAGKTLREAGIAEETGMWVLYIRRGGRWLKPKPNTRLLPGDLVVASGYSEGEEDFKKLL |
| A0A5B7TF51 | 10-96 | LIDYIERFKNISPFTLIEISIKEPSWVIGKNLDEVKFWKNTGATIIAYREGEKIVVSPGPDYRFKAGDIIVVIGSSDVYERVCNFIY |
| A0A177KUH8 | 289-374 | None |
| A0A2R6CVZ5 | 337-415 | None |
| A0A352ACL5 | 477-594 | None |
| A0A3D0I349 | 63-140 | None |
| U1QZZ8 | 66-161 | None |
| A0A251WN32 | 9-90 | None |
| A0A5P9P9Q7 | 173-278 | None |
| A0A847A6H9 | 68-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.