DPCstruct | MC21481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 152 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Standard deviation of domain lengths | 13.00 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837VI39 | 211-289 | RNVDHTQAVSMCEAYAKSHATHPSTVDFSRVLDVAVSDGANGNTRVTSTFTAKNGFNLKLKYNIACLVNTSGLIEATIS |
| A0A5D9DCB8 | 14-107 | GLAIAGCDINEWHLKRKAKEAVSERLRDPDSAKFRNLEVVGPSGSAAVCGEVNGKNGFGAYAGYEHFISEYDGGLVRLESQWGESFE… |
| A0A4D7IT64 | 1-127 | None |
| A0A850FBU8 | 10-95 | None |
| A0A418M3I1 | 148-266 | None |
| A0A7G6ABF4 | 6-107 | None |
| A0A4Q0HHE5 | 3-137 | None |
| A0A2V6IZW6 | 5-102 | None |
| A0A3G6HQX2 | 22-112 | None |
| A0A1T1J2R2 | 46-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.