DPCstruct | MC21480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 9.63 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8GWR0 | 1-85 | MTIAEVEQQEMATLSQNLKIRPDYPRVPFGFMNPEWRIFKSEARPGDKVVRYSTDKDSWQHLAGEAGIALIRSGCLIRTLPTMRN |
| A0A1M5XC24 | 152-237 | LSRDEVELQHPSRAAENLGKKTTIQEVEDEYGLGFEWEKLKPFIRNNDELWAYDTDQESWDHLAGESGVALVRDGEIIASIMIEIS |
| A0A7C1DR05 | 2-98 | None |
| A0A5C7KDN4 | 85-183 | None |
| A0A2T5PKE5 | 29-138 | None |
| A0A373FPM7 | 96-186 | None |
| A0A3D9Z325 | 4-80 | None |
| A0A2V6G0C1 | 172-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.