DPCstruct | MC2148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 446 ± 76 aa |
| Standard deviation of domain lengths | 75.97 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09418 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3F2RS75 | 99-557 | YIPLRLDEEERALFNLLDAALNVSEYTDKVDVLSYRSPVKRVIHELNENFGVLSGLMIANDFRQGRRLVQDKQFKDNKEFFRRVFEI… |
| A0A7J6N0H3 | 123-584 | GGHHSSQASYLNLCSFIPVRLSHDDRRALNLLERALNVSEYTDKVDVYTIRHEKDDLIIDQLDEACSILSGMSVASHQRPPTDFQHW… |
| A0A1C3L2P5 | 2-305 | None |
| A0A3M6V984 | 2-342 | None |
| A0A2R5GPF5 | 104-599 | None |
| A0A812RD47 | 24-471 | None |
| A0A1J8QJG4 | 532-1041 | None |
| A0A5B8MQT8 | 585-1044 | None |
| A0A504X1H7 | 27-446 | None |
| W4H040 | 1-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.