DPCstruct | MC21477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 121 ± 21 aa |
| Standard deviation of domain lengths | 20.84 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09435 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1Y0L5 | 4-115 | LQLFFITLPIVILVLFLVRRVLIKRGYRRLGTGTFLEDLENGLSSETFDILPNIEGGDSRPGLDSEEIHRIMKKHGCTFDEARVIRQ… |
| A0A4T0FNH0 | 14-121 | VVAIAILAALYYKYRHKRQSTNSYIPLDFNNQIELGFRSDNFDTTQNVSDGDSRQGLDVAELREIQHLMKTNKLSFDQARLKRMEYT… |
| A0A1Y2D0F5 | 23-158 | None |
| A0A0K6GAY4 | 239-355 | None |
| A0A4U0XXB1 | 11-142 | None |
| A0A4U0VAT3 | 3-158 | None |
| A0A0F7SCI9 | 41-161 | None |
| X0CCH7 | 14-137 | None |
| X8J404 | 34-156 | None |
| A0A376B251 | 5-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.