DPCstruct | MC21473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 173 ± 36 aa |
| Standard deviation of domain lengths | 35.84 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1Q7G1 | 15-170 | VKTLKYAAQSQLYLHQAGSTALLSFSSNPARLPIGKIKAIDNIGGDYQVTPDNFVENKSFIERLQQVIKDHVADEMMYRLDSLNYRN… |
| A0A178FSC3 | 20-184 | IYVFPNATGTSHTLSLLPTSPPTPDVAIGSTTTSALPPTPTTFSPNPRFISILDSVLADHAYQDPDTVSAAQVMASAAGANLFSRMH… |
| A0A433Q855 | 23-207 | None |
| A0A0M8N1V3 | 10-179 | None |
| A0A838RM27 | 2-122 | None |
| A0A397JL18 | 70-276 | None |
| A0A1V8S8S3 | 241-462 | None |
| A0A4V2MVU9 | 723-865 | None |
| A0A2H9THR7 | 214-384 | None |
| A0A438NG84 | 283-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.