DPCstruct | MC21471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 481 ± 108 aa |
| Standard deviation of domain lengths | 108.32 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.29 |
| Pfam Score | 83.28 |
| Assigned Pfam label(s) | CL0205- CL0129- CL0159- PF03722- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084W7C2 | 194-447 | LWYFREDIGVNLHHWHWHLVYPFDASNRAIVDKDRRGELFYYMHQQLVARYNFERFSNRLQRVKRLNNLREPIGEGYFPKLDSLVAS… |
| A0A178F977 | 30-470 | ANYTGWYMRYNDEQKMAYYTEDIGLQLFYYNNHLDYPFWLGGEEFKLYKDRRGEMYYYKHMQLLARYYLERLSNGLGEIPVMTTNTP… |
| A0A5B7CRV4 | 175-546 | None |
| A0A482WS29 | 101-842 | None |
| Q5AR52 | 94-638 | None |
| A0A226EMK4 | 128-720 | None |
| A0A7R9FWB4 | 227-603 | None |
| A0A6V7LHE6 | 2-393 | None |
| A0A3B0J5Q8 | 19-595 | None |
| T1PE06 | 41-525 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.