DPCstruct | MC21470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 155 |
|---|---|
| Mean domain length (aa) | 144 ± 23 aa |
| Standard deviation of domain lengths | 22.56 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.71 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0345- CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A363TAE9 | 8-136 | PFKLKDFHSVDPKHIARLEAVGVKTADQILKAGRTSPGRSDLAARAGIPPEAILELVKLSDLSRLPGVKGIRARLYYAAGVDTVEKL… |
| A0A662M1A8 | 4-119 | MKITEIKGIGPKYANKLKKAGIKTVYDLREMNIKSVSKAAGIGEQTLAKWKEEAMKMRLLTDIKGIGDAFRKKLEKHGIRTIEELSK… |
| A0A182ALN0 | 1-100 | None |
| A0A353YZC8 | 90-223 | None |
| A0A7C2XYB2 | 20-213 | None |
| A0A842TFR3 | 3-138 | None |
| A0A842TFW1 | 6-115 | None |
| A0A6N6Q0B3 | 373-541 | None |
| A0A7Z9Y2B7 | 259-467 | None |
| A0A378N7N8 | 52-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.