DPCstruct | MC2147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 168 |
|---|---|
| Mean domain length (aa) | 411 ± 101 aa |
| Standard deviation of domain lengths | 101.40 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 74.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.49 |
| Pfam Score | 96.12 |
| Assigned Pfam label(s) | CL0181- PF01322- CL0071- CL0099- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354XQ24 | 3-261 | MSLIWFVLSAAGIVAIAKYALYNPVQRLVAYTRASKVVSGQILGYLTSAPELVSTVFIAATGFFTAAAFNVLGSNVINVFLVITAAL… |
| A0A7J6MT07 | 75-501 | EVDGSSVIPPALDLLISFIIMLYMFKLLGSMCDEYFVQSLSSISEALNLSPDVAGATFMAAGSSAPELFTSVMATFLIVNEGGVGTI… |
| A0A1V8S9Q8 | 1-306 | None |
| K8ET20 | 364-973 | None |
| F4Q040 | 488-881 | None |
| A0A5D3AZB4 | 19-376 | None |
| A0A1B0BLT5 | 49-425 | None |
| A0A6A6L2D6 | 4-417 | None |
| A0A384DNC4 | 24-529 | None |
| A0A498NJY7 | 351-871 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.