DPCstruct | MC21464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 217 ± 35 aa |
| Standard deviation of domain lengths | 34.84 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17811 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3WNX0 | 1-185 | PSGWIHAVYTPSDSLVFGGNFLTLFSIPLQLHVYRMEVSQETEERFLFPCFEKLHWYAADVILGRLTNYLYAGQDPPPYLLKAAHAL… |
| A0A1V2L5K9 | 1-147 | MLKIGNFLTSFNIPEQLKIIDIEIKTKVGKKFKFPNFSKLMWLTAWRVLEGDIEVGETIDAKGCVELLEYLKAQVDRKERGVRQSVP… |
| A0A4Y9XXA3 | 769-993 | None |
| A0A433PA88 | 2-227 | None |
| A0A1Y1K4K9 | 139-382 | None |
| A0A2J7R6E2 | 5-247 | None |
| A0A1B6DFS1 | 12-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.