DPCstruct | MC21463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 149 ± 29 aa |
| Standard deviation of domain lengths | 28.96 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 28.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3SCL4 | 91-224 | QWSKRLLPHLNTTERLNDAMAILSTLGGAYSALGDQLDHFSLKAQRISLRQLYVAKALGDPTLISKSKLYLALSLMQQRRFTRAERI… |
| A0A6H5J0B5 | 3-119 | RLVIQKHDLDVAMSWLSTLGGAFSALGDEFNHCAKVAGKISLAQFKLSLQLGDPQLVARCNLYAALSLIQQGYYKRSKQMIQKLFKF… |
| A0A6V7U001 | 2-109 | None |
| A0A7E4VX96 | 27-168 | None |
| A0A654HPN9 | 37-156 | None |
| A0A6P8GZB6 | 105-270 | None |
| A0A7R9A765 | 3-134 | None |
| F1L4F0 | 63-227 | None |
| A0A482VZL9 | 48-194 | None |
| A0A433DIC1 | 94-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.