DPCstruct | MC21454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 182 ± 16 aa |
| Standard deviation of domain lengths | 15.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536JS21 | 1-200 | MQSGLGLGLLRGHRATVDQSPLLHVTLTGERTGYYEDFAAYELLGKASREVWVYDGVWSRHRQKTRGRQPTDHPRHAFVVAAQNHDQ… |
| A0A2V6N2V2 | 101-296 | DGVWNDDWHHAATVALTGRNEAYYSDYLGCPQEFIAAAKYGYLYQGQPYSWQEAPRGHPSLDLKPEAFVSFLENHDQVSNSATGNRL… |
| A0A7W0YWN6 | 1-165 | None |
| A0A7W1UTE1 | 99-279 | None |
| A0A379VRM2 | 1-174 | None |
| A0A7W0WEA4 | 72-230 | None |
| A0A1S2V9R4 | 10-169 | None |
| A0A6N9H8A0 | 297-499 | None |
| A0A838K0J3 | 2-188 | None |
| A0A8A7BIN1 | 323-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.