DPCstruct | MC21450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 5.79 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 58.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1QCV2 | 45-120 | NDVRQAARSAASYMLFDPEDSVMQQNLVYYRFHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFSHMYLQSDDE |
| A0A4W5KAE3 | 1-90 | MNDLKNAVLCIASYMLFDPSDEVMKNNVVYYQYHRDKYGLSDEDFLPRSEAVRYMNQTTMQLQMLEFSRTRLASDDEGEVLEFLDEF… |
| U3I0I1 | 234-321 | None |
| S9WQ51 | 198-286 | None |
| A0A3Q3X8L6 | 206-281 | None |
| A0A6I8PIX6 | 513-589 | None |
| G5BIU7 | 214-288 | None |
| A0A315UU81 | 358-442 | None |
| A0A5N5KJM6 | 175-250 | None |
| A0A3N0XU73 | 380-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.