DPCstruct | MC21447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.70 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 64.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4ABS1 | 144-225 | AWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKT |
| A0A4W5K457 | 97-181 | SRWFLQFVLQWLGENEDVSMEFMHGALERDKREGFQQTSEHALFSSSVVDIFTQLNQSFEIIKKLDCPDPKVQAHYNRRFAKVTH |
| A0A6P4KGL2 | 57-148 | None |
| A0A2I0T701 | 246-333 | None |
| A0A6H5HE19 | 354-445 | None |
| A0A183Q6L2 | 8-91 | None |
| A0A6I9YZV8 | 690-779 | None |
| A0A820K6L8 | 1-76 | None |
| A0A183LK30 | 353-437 | None |
| A0A4Z2GS20 | 5-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.