DPCstruct | MC21446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 120 ± 18 aa |
| Standard deviation of domain lengths | 17.68 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 51.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5K2V5 | 1-118 | MPEVRQSSFALLGDLTKACFPHVKPCIAEFMPILGTNLNPEFISVCNNATWAIGEICMQMGVEMQPYVSLVLNQLVEIINRPNTPKT… |
| A0A814C8T0 | 24-141 | MAEVRQSSFALLGDLTKACFRHVHKHLNIFLPLLTQNLDPHHVSVCNNAIWAIGEISIHIGSEIQPFVSIILESLISIINRNNTPKT… |
| A0A183VJI7 | 27-132 | None |
| A0A2A6D398 | 1015-1132 | None |
| A0A7R9MT61 | 30-122 | None |
| Q4TI85 | 1-123 | None |
| A0A4W2F3J8 | 885-1030 | None |
| A0A093ZGP9 | 953-1106 | None |
| A0A1B0D732 | 109-210 | None |
| A0A3M7ICJ4 | 980-1104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.