DPCstruct | MC21445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 7.29 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6H3A8 | 85-165 | STVVLADVSQYPVNHLVTFCLGEEDGVHTVEDASRRLAVMDNQGRVWAQEMLLRVSPDRVTLLDPMSKEELESYPLGAIVR |
| A0A183DSH8 | 96-172 | HPSTVESETPSYWVEHLATFAVGREFGLQFPDDGVRKLKQLENNSAIWAQPMVLRLRPNVVSVEDENGDLVEQFPME |
| A0A3S2PEP8 | 151-245 | None |
| A0A444UH75 | 140-221 | None |
| A0A131XDG2 | 46-128 | None |
| A0A3B3TPK2 | 36-110 | None |
| A0A4Z2JCG2 | 37-104 | None |
| A0A674JKR1 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.