DPCstruct | MC21444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 109 ± 4 aa |
| Standard deviation of domain lengths | 4.37 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1FVX4 | 290-396 | EEAMQALRNLILLVGSLCSCGFIELKPNLKTSSLFHMPGFVVPQSAGNGMSVRNLQAFQVLQTVFLRASSKQLCSTILDVMISLYNQ… |
| A0A7R8VX61 | 1-106 | MVASLSMCGYIELRPSQASMGSLFQMMGFTLPLPSGRGASVRNIQAFQVLQSVFLKSNSAVLCCTILDAISSVYHADNANYFILEGQ… |
| T1GN58 | 63-169 | None |
| A0A2M4AH30 | 62-181 | None |
| A0A3P8JIV7 | 11-118 | None |
| W6V355 | 174-280 | None |
| A0A1B0D248 | 66-175 | None |
| A0A182YSU3 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.