DPCstruct | MC21443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 150 ± 12 aa |
| Standard deviation of domain lengths | 12.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5JZ39 | 1-168 | MAFCLAELHCWSSSSSLQVKARGYSWTPRNRRPEKLRDSLEKLEELLQTNSVVHSRWKSKHCCQLMLSSGVLVTLALNGPQLDRVCV… |
| A0A2S2P7M0 | 31-178 | EKKETETSTDKIIKKNYVEASGCNWSVSNKRPLKLRDSLKYFETELNDHYLIAVEWIKKDKIAFIFNNGSTIFVTFDPVTCDIVEIV… |
| A0A1A8N1Q2 | 43-185 | None |
| S4RP91 | 36-179 | None |
| A0A5B7D5J4 | 41-165 | None |
| A0A7R8HAP2 | 79-229 | None |
| A0A653DH11 | 38-205 | None |
| K1RF96 | 7-167 | None |
| B3RW68 | 33-176 | None |
| A0A336MF77 | 15-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.