DPCstruct | MC21441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 138 ± 14 aa |
| Standard deviation of domain lengths | 13.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q64599 | 65-207 | EKGDVAFVKDQTVIQNTDGNNNEAWAKNMKKENFEVLCKDGTRKPVTDAENCHLPEPNHAVVSRKDKATCVEKILNKQQDDFGKSVT… |
| A0A4W5JUH2 | 32-162 | LLSIYPSFPVGSGPVWAKDLKSSDFELLCQDGTTQPVSKFLECHLAKVPAHAVITRPETRKEVVSILLEQQARFGSTGSDSSFKMFQ… |
| A0A6J3DIG9 | 562-693 | None |
| A0A7N4PCF4 | 606-768 | None |
| A0A4U5UKU1 | 548-700 | None |
| A0A6J1NV42 | 12-142 | None |
| A0A423TE04 | 556-704 | None |
| A0A1I8IE29 | 159-292 | None |
| V8NGU6 | 78-202 | None |
| H3BCA2 | 108-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.